Lineage for d2rmra_ (2rmr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328543Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 2328544Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 2328545Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 2328546Protein Sin3A [47766] (1 species)
  7. 2328547Species Mouse (Mus musculus) [TaxId:10090] [47767] (5 PDB entries)
    Uniprot Q96ST3 295-383
  8. 2328548Domain d2rmra_: 2rmr A: [243726]
    automated match to d1s5qb_

Details for d2rmra_

PDB Entry: 2rmr (more details)

PDB Description: solution structure of msin3a pah1 domain
PDB Compounds: (A:) Paired amphipathic helix protein Sin3a

SCOPe Domain Sequences for d2rmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmra_ a.59.1.1 (A:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]}
qrlkvedalsyldqvklqfgsqpqvyndfldimkefksqsidtpgvisrvsqlfkghpdl
imgfntflppg

SCOPe Domain Coordinates for d2rmra_:

Click to download the PDB-style file with coordinates for d2rmra_.
(The format of our PDB-style files is described here.)

Timeline for d2rmra_: