Lineage for d2rmoa_ (2rmo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783262Species Chicken (Gallus gallus) [TaxId:9031] [187080] (10 PDB entries)
  8. 2783275Domain d2rmoa_: 2rmo A: [243725]
    automated match to d2f2va_

Details for d2rmoa_

PDB Entry: 2rmo (more details)

PDB Description: solution structure of alpha-spectrin_sh3-bergerac from chicken
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d2rmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmoa_ b.34.2.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevkatangktyerqgf
vpaayvkkld

SCOPe Domain Coordinates for d2rmoa_:

Click to download the PDB-style file with coordinates for d2rmoa_.
(The format of our PDB-style files is described here.)

Timeline for d2rmoa_: