SCOPe 2.05: Domain d2rmmb_: 2rmm B:

Lineage for d2rmmb_ (2rmm B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp. [TaxId:1320] [193546] (3 PDB entries)

8. Domain d2rmmb_: 2rmm B: [243724]
   automated match to d2qmta_
   mutant

Details for d2rmmb_

PDB Entry: 2rmm

PDB Description: solution structure of gb1 a34f mutant

PDB Compounds: (B:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2rmmb_:

Sequence; same for both SEQRES and ATOM records:

>d2rmmb_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
mqyklilngktlkgettteavdaataekvfkqyfndngvdgewtyddatktftvte

Timeline for d2rmmb_:

• d2rmmb_ first appeared in SCOPe 2.04
  
• d2rmmb_ is called d2rmmb1 in SCOPe 2.06
  
• d2rmmb_ appears in the current release, SCOPe 2.08, called d2rmmb1