![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
![]() | Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
![]() | Species Streptococcus sp. [TaxId:1320] [193546] (13 PDB entries) |
![]() | Domain d2rmmb1: 2rmm B:3-56 [243724] Other proteins in same PDB: d2rmma2, d2rmmb2 automated match to d2qmta_ mutant |
PDB Entry: 2rmm (more details)
SCOPe Domain Sequences for d2rmmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmmb1 d.15.7.1 (B:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]} yklilngktlkgettteavdaataekvfkqyfndngvdgewtyddatktftvte
Timeline for d2rmmb1: