Lineage for d2rmmb1 (2rmm B:3-56)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934672Species Streptococcus sp. [TaxId:1320] [193546] (13 PDB entries)
  8. 2934699Domain d2rmmb1: 2rmm B:3-56 [243724]
    Other proteins in same PDB: d2rmma2, d2rmmb2
    automated match to d2qmta_
    mutant

Details for d2rmmb1

PDB Entry: 2rmm (more details)

PDB Description: solution structure of gb1 a34f mutant
PDB Compounds: (B:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2rmmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmmb1 d.15.7.1 (B:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
yklilngktlkgettteavdaataekvfkqyfndngvdgewtyddatktftvte

SCOPe Domain Coordinates for d2rmmb1:

Click to download the PDB-style file with coordinates for d2rmmb1.
(The format of our PDB-style files is described here.)

Timeline for d2rmmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rmmb2