Lineage for d2rjma2 (2rjm A:93-186)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1521191Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (12 PDB entries)
  8. 1521202Domain d2rjma2: 2rjm A:93-186 [243715]
    automated match to d1fhga_

Details for d2rjma2

PDB Entry: 2rjm (more details), 2 Å

PDB Description: 3Ig structure of titin domains I67-I69 E-to-A mutated variant
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d2rjma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjma2 b.1.1.0 (A:93-186) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
apprfikklepsrivkqdehtryeckiggspeikvlwykdeteiqesskfrmsfvesvav
lemynlsvedsgdytceahnaagsassstslkvk

SCOPe Domain Coordinates for d2rjma2:

Click to download the PDB-style file with coordinates for d2rjma2.
(The format of our PDB-style files is described here.)

Timeline for d2rjma2: