Lineage for d2rjda3 (2rjd A:422-528)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784818Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2784821Domain d2rjda3: 2rjd A:422-528 [243713]
    automated match to d1oz3a3

Details for d2rjda3

PDB Entry: 2rjd (more details), 1.65 Å

PDB Description: Crystal structure of L3MBTL1 protein
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d2rjda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjda3 b.34.9.0 (A:422-528) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fcwekyleetgasavptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhriki
hfdgwshgydfwidadhpdihpagwcsktghplqpplgprepssasp

SCOPe Domain Coordinates for d2rjda3:

Click to download the PDB-style file with coordinates for d2rjda3.
(The format of our PDB-style files is described here.)

Timeline for d2rjda3: