SCOPe 2.05: Domain d2rjda2: 2rjd A:314-421

Lineage for d2rjda2 (2rjd A:314-421)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries)

8. Domain d2rjda2: 2rjd A:314-421 [243712]
   automated match to d1oz2a2

Details for d2rjda2

PDB Entry: 2rjd, 1.65 Å

PDB Description: Crystal structure of L3MBTL1 protein

PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d2rjda2:

Sequence, based on SEQRES records:

>d2rjda2 b.34.9.0 (A:314-421) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn

Sequence, based on observed residues (ATOM records):

>d2rjda2 b.34.9.0 (A:314-421) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrflv
hfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn

Timeline for d2rjda2:

• d2rjda2 first appeared in SCOPe 2.04
  
• d2rjda2 appears in SCOPe 2.06
  
• d2rjda2 appears in the current release, SCOPe 2.08