Lineage for d1f49f4 (1f49 F:731-1023)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795492Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 795493Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 795494Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 795502Species Escherichia coli [TaxId:562] [49997] (25 PDB entries)
    Uniprot P00722
  8. 795564Domain d1f49f4: 1f49 F:731-1023 [24371]
    Other proteins in same PDB: d1f49a1, d1f49a2, d1f49a3, d1f49a5, d1f49b1, d1f49b2, d1f49b3, d1f49b5, d1f49c1, d1f49c2, d1f49c3, d1f49c5, d1f49d1, d1f49d2, d1f49d3, d1f49d5, d1f49e1, d1f49e2, d1f49e3, d1f49e5, d1f49f1, d1f49f2, d1f49f3, d1f49f5, d1f49g1, d1f49g2, d1f49g3, d1f49g5, d1f49h1, d1f49h2, d1f49h3, d1f49h5

Details for d1f49f4

PDB Entry: 1f49 (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (F:) beta-galactosidase

SCOP Domain Sequences for d1f49f4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f49f4 b.30.5.1 (F:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1f49f4:

Click to download the PDB-style file with coordinates for d1f49f4.
(The format of our PDB-style files is described here.)

Timeline for d1f49f4: