Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (17 PDB entries) |
Domain d2rika3: 2rik A:187-280 [243701] automated match to d1fhga_ |
PDB Entry: 2rik (more details), 1.6 Å
SCOPe Domain Sequences for d2rika3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rika3 b.1.1.0 (A:187-280) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} eppvfrkkphpvetlkgadvhlecelqgtppfqvswhkdkrelrsgkkykimsenfltsi hilnvdsadigeyqckasndvgsytcvgsitlka
Timeline for d2rika3: