| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
| Domain d2rika1: 2rik A:-2-92 [243699] automated match to d1fhga_ |
PDB Entry: 2rik (more details), 1.6 Å
SCOPe Domain Sequences for d2rika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rika1 b.1.1.0 (A:-2-92) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
amappffdlkpvsvdlalgesgtfkchvtgtapikitwakdnreirpggnykmtlventa
tltvlkvtkgdagqytcyasnvagkdscsaqlgvq
Timeline for d2rika1: