| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) |
| Domain d2ri3a1: 2ri3 A:206-313 [243693] Other proteins in same PDB: d2ri3a4 automated match to d1oz3a1 complexed with peg; mutant |
PDB Entry: 2ri3 (more details), 2 Å
SCOPe Domain Sequences for d2ri3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ri3a1 b.34.9.0 (A:206-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee
Timeline for d2ri3a1: