SCOPe 2.06: Domain d2rhya1: 2rhy A:206-313

Lineage for d2rhya1 (2rhy A:206-313)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (21 PDB entries)

8. Domain d2rhya1: 2rhy A:206-313 [243684]
   Other proteins in same PDB: d2rhya4
   automated match to d1oz3a1
   complexed with mlz, peg

Details for d2rhya1

PDB Entry: 2rhy, 1.9 Å

PDB Description: Crystal structure of the 3-MBT repeats from human L3MBTL1 bound to monomethyl-lysine

PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d2rhya1:

Sequence; same for both SEQRES and ATOM records:

>d2rhya1 b.34.9.0 (A:206-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaevcg
yrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee

Timeline for d2rhya1:

• d2rhya1 first appeared in SCOPe 2.04
  
• d2rhya1 appears in SCOPe 2.05
  
• d2rhya1 appears in SCOPe 2.07
  
• d2rhya1 appears in the current release, SCOPe 2.08