Lineage for d2rhxa1 (2rhx A:204-313)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784737Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1784908Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 1784909Protein automated matches [191144] (3 species)
    not a true protein
  7. 1784919Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries)
  8. 1784952Domain d2rhxa1: 2rhx A:204-313 [243681]
    automated match to d1oz3a1
    complexed with mly, pg4, pge, so4

Details for d2rhxa1

PDB Entry: 2rhx (more details), 2.1 Å

PDB Description: Crystal structure of the 3-MBT repeats from human L3MBTL1 bound to dimethyl-lysine
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d2rhxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhxa1 b.34.9.0 (A:204-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaev
cgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee

SCOPe Domain Coordinates for d2rhxa1:

Click to download the PDB-style file with coordinates for d2rhxa1.
(The format of our PDB-style files is described here.)

Timeline for d2rhxa1: