Lineage for d2rh8a_ (2rh8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (233 species)
    not a true protein
  7. 2095011Species Grape (Vitis vinifera) [TaxId:29760] [255079] (11 PDB entries)
  8. 2095026Domain d2rh8a_: 2rh8 A: [243680]
    automated match to d2p4hx_
    complexed with cl

Details for d2rh8a_

PDB Entry: 2rh8 (more details), 2.22 Å

PDB Description: Structure of apo anthocyanidin reductase from vitis vinifera
PDB Compounds: (A:) Anthocyanidin reductase

SCOPe Domain Sequences for d2rh8a_:

Sequence, based on SEQRES records: (download)

>d2rh8a_ c.2.1.0 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
kktacvvggtgfvasllvklllqkgyavnttvrdpdnqkkvshllelqelgdlkifradl
tdelsfeapiagcdfvfhvatpvhfasedpendmikpaiqgvvnvmkactraksvkrvil
tssaaavtinqldgtglvvdeknwtdiefltsakpptwgypasktlaekaawkfaeenni
dlitviptlmagssltsdvpssiglamslitgneflingmkgmqmlsgsvsiahvedvcr
ahifvaekesasgryiccaantsvpelakflskrypqykvptdfgdfppkskliissekl
vkegfsfkygieeiydesveyfkakgll

Sequence, based on observed residues (ATOM records): (download)

>d2rh8a_ c.2.1.0 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
kktacvvggtgfvasllvklllqkgyavnttvrdpdnqkkvshllelqelgdlkifradl
tdelsfeapiagcdfvfhvatpvhfikpaiqgvvnvmkactraksvkrviltssaaavti
nqldgtglvvdeknwtdipptwgypasktlaekaawkfaeennidlitviptlmagsslt
sdvpssiglamslitgneflingmkgmqmlsgsvsiahvedvcrahifvaekesasgryi
ccaantsvpelakflskrypqykvptdfgdfppkskliisseklvkegfsfkygieeiyd
esveyfkakgll

SCOPe Domain Coordinates for d2rh8a_:

Click to download the PDB-style file with coordinates for d2rh8a_.
(The format of our PDB-style files is described here.)

Timeline for d2rh8a_: