SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2rh8a_ (2rh8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2095011Species Grape (Vitis vinifera) [TaxId:29760] [255079] (11 PDB entries)
  8. 2095026Domain d2rh8a_: 2rh8 A: [243680]
    automated match to d2p4hx_
    complexed with cl

Details for d2rh8a_

PDB Entry: 2rh8 (more details), 2.22 Å

PDB Description: Structure of apo anthocyanidin reductase from vitis vinifera
PDB Compounds: (A:) Anthocyanidin reductase

SCOPe Domain Sequences for d2rh8a_:

Sequence, based on SEQRES records: (download)

>d2rh8a_ c.2.1.0 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
kktacvvggtgfvasllvklllqkgyavnttvrdpdnqkkvshllelqelgdlkifradl
tdelsfeapiagcdfvfhvatpvhfasedpendmikpaiqgvvnvmkactraksvkrvil
tssaaavtinqldgtglvvdeknwtdiefltsakpptwgypasktlaekaawkfaeenni
dlitviptlmagssltsdvpssiglamslitgneflingmkgmqmlsgsvsiahvedvcr
ahifvaekesasgryiccaantsvpelakflskrypqykvptdfgdfppkskliissekl
vkegfsfkygieeiydesveyfkakgll

Sequence, based on observed residues (ATOM records): (download)

>d2rh8a_ c.2.1.0 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
kktacvvggtgfvasllvklllqkgyavnttvrdpdnqkkvshllelqelgdlkifradl
tdelsfeapiagcdfvfhvatpvhfikpaiqgvvnvmkactraksvkrviltssaaavti
nqldgtglvvdeknwtdipptwgypasktlaekaawkfaeennidlitviptlmagsslt
sdvpssiglamslitgneflingmkgmqmlsgsvsiahvedvcrahifvaekesasgryi
ccaantsvpelakflskrypqykvptdfgdfppkskliisseklvkegfsfkygieeiyd
esveyfkakgll

SCOPe Domain Coordinates for d2rh8a_:

Click to download the PDB-style file with coordinates for d2rh8a_.
(The format of our PDB-style files is described here.)

Timeline for d2rh8a_: