Lineage for d2rfcc_ (2rfc C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005803Species Picrophilus torridus [TaxId:82076] [188332] (2 PDB entries)
  8. 2005809Domain d2rfcc_: 2rfc C: [243678]
    automated match to d2rfbb_
    complexed with hem, pim

Details for d2rfcc_

PDB Entry: 2rfc (more details), 3.1 Å

PDB Description: Ligand bound (4-phenylimidazole) Crystal Structure of a Cytochrome P450 from the Thermoacidophilic Archaeon Picrophilus Torridus
PDB Compounds: (C:) cytochrome p450

SCOPe Domain Sequences for d2rfcc_:

Sequence, based on SEQRES records: (download)

>d2rfcc_ a.104.1.0 (C:) automated matches {Picrophilus torridus [TaxId: 82076]}
lndpvhydgawhvykysdvkhvlmndkifssnpgnrysnaggisfitmdnpehkefrdis
apyflpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfk
lwsdyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyi
mlliiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaae
dsyinnkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplar
leasialndilnhfkrikidykksrlldnkmvlgydklfls

Sequence, based on observed residues (ATOM records): (download)

>d2rfcc_ a.104.1.0 (C:) automated matches {Picrophilus torridus [TaxId: 82076]}
lndpvhydgawhvykysdvkhvlmndkifssnpgnrysgisfitmdnpehkefrdisapy
flpskindykdfieetsndliknidnkdiiseyavrlpvniiskilgipdsdmplfklws
dyiignkrdenfnyvnnrmvsrlleifksdshgiinvlagsslknrkltmdekikyimll
iiggnetttnlignmirvidenpdiiddalknrsgfveetlryyspiqflphrfaaedsy
innkkikkgdqvivylgsanrdetffdepdlfkigrremhlafgigihmclgaplarlea
sialndilnhfkrikidykksrlldnkmvlgydklfls

SCOPe Domain Coordinates for d2rfcc_:

Click to download the PDB-style file with coordinates for d2rfcc_.
(The format of our PDB-style files is described here.)

Timeline for d2rfcc_: