SCOPe 2.07: Domain d2rf0b_: 2rf0 B:

Lineage for d2rf0b_ (2rf0 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)

8. Domain d2rf0b_: 2rf0 B: [243673]
   automated match to d2d1xc_
   complexed with edo

Details for d2rf0b_

PDB Entry: 2rf0, 2 Å

PDB Description: crystal structure of human mixed lineage kinase map3k10 sh3 domain

PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 10

SCOPe Domain Sequences for d2rf0b_:

Sequence, based on SEQRES records:

>d2rf0b_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agpvwtavfdyeaagdeeltlrrgdrvqvlsqdcavsgdegwwtgqlpsgrvgvfpsnyv
ap

Sequence, based on observed residues (ATOM records):

>d2rf0b_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agpvwtavfdyeaagdeeltlrrgdrvqvlsqdegwwtgqlpsgrvgvfpsnyvap

Timeline for d2rf0b_:

• d2rf0b_ first appeared in SCOPe 2.04
  
• d2rf0b_ appears in SCOPe 2.06
  
• d2rf0b_ appears in the current release, SCOPe 2.08