Lineage for d2rf0b_ (2rf0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783516Domain d2rf0b_: 2rf0 B: [243673]
    automated match to d2d1xc_
    complexed with edo

Details for d2rf0b_

PDB Entry: 2rf0 (more details), 2 Å

PDB Description: crystal structure of human mixed lineage kinase map3k10 sh3 domain
PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 10

SCOPe Domain Sequences for d2rf0b_:

Sequence, based on SEQRES records: (download)

>d2rf0b_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agpvwtavfdyeaagdeeltlrrgdrvqvlsqdcavsgdegwwtgqlpsgrvgvfpsnyv
ap

Sequence, based on observed residues (ATOM records): (download)

>d2rf0b_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agpvwtavfdyeaagdeeltlrrgdrvqvlsqdegwwtgqlpsgrvgvfpsnyvap

SCOPe Domain Coordinates for d2rf0b_:

Click to download the PDB-style file with coordinates for d2rf0b_.
(The format of our PDB-style files is described here.)

Timeline for d2rf0b_: