SCOPe 2.06: Domain d2rccb_: 2rcc B:

Lineage for d2rccb_ (2rcc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [255581] (1 PDB entry)

8. Domain d2rccb_: 2rcc B: [243671]
   automated match to d1uzra_
   complexed with edo, gol, peg, pg4, pge, zn

Details for d2rccb_

PDB Entry: 2rcc, 1.9 Å

PDB Description: crystal structure of putative class i ribonucleotide reductase (np_241368.1) from bacillus halodurans at 1.90 a resolution

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d2rccb_:

Sequence; same for both SEQRES and ATOM records:

>d2rccb_ a.25.1.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
fswayplyknmlanfwtpfeinmshdakqfptlteteqeafkkiigllafldsvqtdysm
raaeyltdsslaalmsvlsfqevvhnqsysyvlsslvpkatqdeifeywkhddvlkerne
fiidgyekfvdnptpktflesivydvileglnfysgfaffynlarnqkmvststminyin
rdeqlhvylftnifkellvefpelnteetktfvkttlmkaadlekdwfryiigdkipgin
pedmetyisfiankravqlgmekpypeikhnpmkwiraye

Timeline for d2rccb_:

• d2rccb_ first appeared in SCOPe 2.04
  
• d2rccb_ appears in SCOPe 2.05
  
• d2rccb_ appears in SCOPe 2.07
  
• d2rccb_ appears in the current release, SCOPe 2.08