Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [255581] (1 PDB entry) |
Domain d2rccb_: 2rcc B: [243671] automated match to d1uzra_ complexed with edo, gol, peg, pg4, pge, zn |
PDB Entry: 2rcc (more details), 1.9 Å
SCOPe Domain Sequences for d2rccb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rccb_ a.25.1.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]} fswayplyknmlanfwtpfeinmshdakqfptlteteqeafkkiigllafldsvqtdysm raaeyltdsslaalmsvlsfqevvhnqsysyvlsslvpkatqdeifeywkhddvlkerne fiidgyekfvdnptpktflesivydvileglnfysgfaffynlarnqkmvststminyin rdeqlhvylftnifkellvefpelnteetktfvkttlmkaadlekdwfryiigdkipgin pedmetyisfiankravqlgmekpypeikhnpmkwiraye
Timeline for d2rccb_: