Lineage for d2rccb_ (2rcc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2703992Species Bacillus halodurans [TaxId:272558] [255581] (1 PDB entry)
  8. 2703993Domain d2rccb_: 2rcc B: [243671]
    automated match to d1uzra_
    complexed with edo, gol, peg, pg4, pge, zn

Details for d2rccb_

PDB Entry: 2rcc (more details), 1.9 Å

PDB Description: crystal structure of putative class i ribonucleotide reductase (np_241368.1) from bacillus halodurans at 1.90 a resolution
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d2rccb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rccb_ a.25.1.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
fswayplyknmlanfwtpfeinmshdakqfptlteteqeafkkiigllafldsvqtdysm
raaeyltdsslaalmsvlsfqevvhnqsysyvlsslvpkatqdeifeywkhddvlkerne
fiidgyekfvdnptpktflesivydvileglnfysgfaffynlarnqkmvststminyin
rdeqlhvylftnifkellvefpelnteetktfvkttlmkaadlekdwfryiigdkipgin
pedmetyisfiankravqlgmekpypeikhnpmkwiraye

SCOPe Domain Coordinates for d2rccb_:

Click to download the PDB-style file with coordinates for d2rccb_.
(The format of our PDB-style files is described here.)

Timeline for d2rccb_: