![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [225189] (2 PDB entries) |
![]() | Domain d2rbca_: 2rbc A: [243670] automated match to d3in1a_ complexed with cl, edo, gol, so4 |
PDB Entry: 2rbc (more details), 1.9 Å
SCOPe Domain Sequences for d2rbca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rbca_ c.72.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} ggkhvlcvgaavldtlfrvadmpkgegkvlpyevlqiaegmassaayavhrmggraslwg avgddetgtrilrdlsesgidtsgmtvapgarsalstiiidnrgerlivpfydhrlhekk ractpedialfdavlvdvrwpelaldvltvaralgkpaildgdvapvetleglapaathi vfsepaatrltgletvkdmlpvlharypqtfiavtagpagcwwteaddptvhfqttmqve avdtlaagdifhgtfalamaegmqsraavrlssvaaalkctvfggrigaptreeteeamr qwlere
Timeline for d2rbca_: