SCOPe 2.06: Domain d2r9va3: 2r9v A:373-503

Lineage for d2r9va3 (2r9v A:373-503)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (11 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [255580] (1 PDB entry)

8. Domain d2r9va3: 2r9v A:373-503 [243669]
   Other proteins in same PDB: d2r9va1, d2r9va2
   automated match to d1skyb1
   complexed with atp, cl, mg, pg4

Details for d2r9va3

PDB Entry: 2r9v, 2.1 Å

PDB Description: crystal structure of atp synthase subunit alpha (tm1612) from thermotoga maritima at 2.10 a resolution

PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d2r9va3:

Sequence; same for both SEQRES and ATOM records:

>d2r9va3 a.69.1.0 (A:373-503) automated matches {Thermotoga maritima [TaxId: 243274]}
ikamkqvagmlridlaqyreletfaqfateldpatraqiirgqrlmellkqeqyspmpve
eqvvvlfagvrgylddlpveevrrfekeflrfmhekhqdilddiktkkeltseteeklkk
aieefkttfrv

Timeline for d2r9va3:

• d2r9va3 first appeared in SCOPe 2.04
  
• d2r9va3 appears in SCOPe 2.05
  
• d2r9va3 appears in SCOPe 2.07
  
• d2r9va3 appears in the current release, SCOPe 2.08