Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (11 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [255580] (1 PDB entry) |
Domain d2r9va3: 2r9v A:373-503 [243669] Other proteins in same PDB: d2r9va1, d2r9va2 automated match to d1skyb1 complexed with atp, cl, mg, pg4 |
PDB Entry: 2r9v (more details), 2.1 Å
SCOPe Domain Sequences for d2r9va3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9va3 a.69.1.0 (A:373-503) automated matches {Thermotoga maritima [TaxId: 243274]} ikamkqvagmlridlaqyreletfaqfateldpatraqiirgqrlmellkqeqyspmpve eqvvvlfagvrgylddlpveevrrfekeflrfmhekhqdilddiktkkeltseteeklkk aieefkttfrv
Timeline for d2r9va3: