SCOPe 2.06: Domain d2r9va1: 2r9v A:17-96

Lineage for d2r9va1 (2r9v A:17-96)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [255579] (1 PDB entry)

8. Domain d2r9va1: 2r9v A:17-96 [243667]
   Other proteins in same PDB: d2r9va2, d2r9va3
   automated match to d1skyb2
   complexed with atp, cl, mg, pg4

Details for d2r9va1

PDB Entry: 2r9v, 2.1 Å

PDB Description: crystal structure of atp synthase subunit alpha (tm1612) from thermotoga maritima at 2.10 a resolution

PDB Compounds: (A:) ATP synthase subunit alpha

SCOPe Domain Sequences for d2r9va1:

Sequence; same for both SEQRES and ATOM records:

>d2r9va1 b.49.1.0 (A:17-96) automated matches {Thermotoga maritima [TaxId: 243274]}
ksfeekidledtgkviqvgdgiarayglnkvmvselvefvetgvkgvafnleednvgiii
lgeykdikeghtvrrlkrii

Timeline for d2r9va1:

• d2r9va1 first appeared in SCOPe 2.04
  
• d2r9va1 appears in SCOPe 2.05
  
• d2r9va1 appears in SCOPe 2.07
  
• d2r9va1 appears in the current release, SCOPe 2.08