SCOPe 2.08: Domain d2r8wb_: 2r8w B:

Lineage for d2r8wb_ (2r8w B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [188284] (2 PDB entries)

8. Domain d2r8wb_: 2r8w B: [243666]
   automated match to d3flua_
   complexed with act, cl

Details for d2r8wb_

PDB Entry: 2r8w, 1.8 Å

PDB Description: The crystal structure of dihydrodipicolinate synthase (Atu0899) from Agrobacterium tumefaciens str. C58

PDB Compounds: (B:) AGR_C_1641p

SCOPe Domain Sequences for d2r8wb_:

Sequence; same for both SEQRES and ATOM records:

>d2r8wb_ c.1.10.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
etdmatrfkglsafpitpadeagrvdieafsaliarldaaevdsvgilgstgiymyltre
errraieaaatilrgrrtlmagigalrtdeavalakdaeaagadalllapvsytpltqee
ayhhfaavagatalplaiynnptttrftfsdellvrlayipniraikmplpadadyagel
arlrpklsddfaigysgdwgctdatlaggdtwysvvagllpvpalqlmraaqagnaeeak
rldatfqplwalfkefgsirviyaaanilsltvsepprpilpltsaerqrveealeals

Timeline for d2r8wb_:

• d2r8wb_ first appeared in SCOPe 2.04
  
• d2r8wb_ appears in SCOPe 2.07