Lineage for d2r8qb_ (2r8q B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737537Species Leishmania major [TaxId:5664] [255578] (1 PDB entry)
  8. 2737539Domain d2r8qb_: 2r8q B: [243664]
    automated match to d4i15a_
    complexed with ibm, mg, zn

Details for d2r8qb_

PDB Entry: 2r8q (more details), 1.5 Å

PDB Description: Structure of LmjPDEB1 in complex with IBMX
PDB Compounds: (B:) Class I phosphodiesterase PDEB1

SCOPe Domain Sequences for d2r8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8qb_ a.211.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]}
viavtpeereavmsidfggaydftspgfnlfevrekysepmdaaagvvynllwnsglpek
fgcreqtllnfilqcrrryrrvpyhnfyhvvdvcqtlhtylytgkaselltelecyvllv
talvhdldhmgvnnsfylktdsplgilssasgnnsvlevhhcslaieilsdpaadvfegl
sgqdvayayralidcvlatdmakhadalsrftelatsgfekdndthrrlvmetlikagdv
snvtkpfetsrmwamavteefyrqgdmekekgvevlpmfdrsknnelargqigfidfvag
kffrdivgnlfhgmqwcvdtvnsnrakwqeildgr

SCOPe Domain Coordinates for d2r8qb_:

Click to download the PDB-style file with coordinates for d2r8qb_.
(The format of our PDB-style files is described here.)

Timeline for d2r8qb_: