![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
![]() | Protein automated matches [190983] (12 species) not a true protein |
![]() | Species Leishmania major [TaxId:5664] [255578] (1 PDB entry) |
![]() | Domain d2r8qb_: 2r8q B: [243664] automated match to d4i15a_ complexed with ibm, mg, zn |
PDB Entry: 2r8q (more details), 1.5 Å
SCOPe Domain Sequences for d2r8qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8qb_ a.211.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]} viavtpeereavmsidfggaydftspgfnlfevrekysepmdaaagvvynllwnsglpek fgcreqtllnfilqcrrryrrvpyhnfyhvvdvcqtlhtylytgkaselltelecyvllv talvhdldhmgvnnsfylktdsplgilssasgnnsvlevhhcslaieilsdpaadvfegl sgqdvayayralidcvlatdmakhadalsrftelatsgfekdndthrrlvmetlikagdv snvtkpfetsrmwamavteefyrqgdmekekgvevlpmfdrsknnelargqigfidfvag kffrdivgnlfhgmqwcvdtvnsnrakwqeildgr
Timeline for d2r8qb_: