![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255576] (4 PDB entries) |
![]() | Domain d2r55b1: 2r55 B:6-213 [243658] Other proteins in same PDB: d2r55a2, d2r55b2 automated match to d1jssa_ |
PDB Entry: 2r55 (more details), 2.5 Å
SCOPe Domain Sequences for d2r55b1:
Sequence, based on SEQRES records: (download)
>d2r55b1 d.129.3.0 (B:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} aaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtleevw dcvkpavgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvlvkry edgtissnathvehplcppkpgfvrgfnhpcgcfceplpgeptktnlvtffhtdlsgylp qnvvdsffprsmtrfyanlqkavkqfhe
>d2r55b1 d.129.3.0 (B:6-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} aaqmseavaekmlqyrrdtagwkicregngvsvswrpsvefpgnlyrgegivygtleevw dcvkpgglrvkwdenvtgfeiiqsitdtlcvsrtstpsaamklisprdfvdlvlvkryed gtissnathvehplcppkpgfvrgfnhpcgcfceplpptktnlvtffhtdlsgylpqnvv dsffprsmtrfyanlqkavkqfhe
Timeline for d2r55b1: