Lineage for d2r3ea_ (2r3e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904689Species Enterococcus faecalis [TaxId:226185] [187075] (3 PDB entries)
  8. 2904694Domain d2r3ea_: 2r3e A: [243654]
    automated match to d1kyha_
    complexed with edo

Details for d2r3ea_

PDB Entry: 2r3e (more details), 1.95 Å

PDB Description: crystal structure of a ribokinase-like superfamily protein (ef1790) from enterococcus faecalis v583 at 1.95 a resolution
PDB Compounds: (A:) YjeF-related protein

SCOPe Domain Sequences for d2r3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3ea_ c.72.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mrylskdileevitqrpsdsyksnfgrvvliggnrqyggaiimsteacinsgaglttvit
dvknhgplharcpeamvvgfeetvlltnvveqadviligpglgldataqqilkmvlaqhq
kqqwliidgsaitlfsqgnfsltypekvvftphqmewqrlshlpieqqtlannqrqqakl
gstivlkshrttifhagepfqntggnpgmatggtgdtlagiiagflaqfkptietiagav
ylhsligddlaktdyvvlptkisqalptymkkyaqp

SCOPe Domain Coordinates for d2r3ea_:

Click to download the PDB-style file with coordinates for d2r3ea_.
(The format of our PDB-style files is described here.)

Timeline for d2r3ea_: