SCOPe 2.05: Domain d2r3bb_: 2r3b B:

Lineage for d2r3bb_ (2r3b B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (37 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [187075] (3 PDB entries)

8. Domain d2r3bb_: 2r3b B: [243653]
   automated match to d1kyha_
   complexed with cl, edo, mg

Details for d2r3bb_

PDB Entry: 2r3b, 1.8 Å

PDB Description: crystal structure of a ribokinase-like superfamily protein (ef1790) from enterococcus faecalis v583 at 1.80 a resolution

PDB Compounds: (B:) YjeF-related protein

SCOPe Domain Sequences for d2r3bb_:

Sequence; same for both SEQRES and ATOM records:

>d2r3bb_ c.72.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
henlyfqgmrylskdileevitqrpsdsyksnfgrvvliggnrqyggaiimsteacinsg
aglttvitdvknhgplharcpeamvvgfeetvlltnvveqadviligpglgldataqqil
kmvlaqhqkqqwliidgsaitlfsqgnfsltypekvvftphqmewqrlshlpieqqtlan
nqrqqaklgstivlkshrttifhagepfqntggnpgmatggtgdtlagiiagflaqfkpt
ietiagavylhsligddlaktdyvvlptkisqalptymkkyaqp

Timeline for d2r3bb_:

• d2r3bb_ first appeared in SCOPe 2.04
  
• d2r3bb_ is called d2r3bb1 in SCOPe 2.06
  
• d2r3bb_ appears in the current release, SCOPe 2.08, called d2r3bb1