SCOPe 2.08: Domain d2qvcb1: 2qvc B:33-333

Lineage for d2qvcb1 (2qvc B:33-333)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [187722] (4 PDB entries)

8. Domain d2qvcb1: 2qvc B:33-333 [243649]
   Other proteins in same PDB: d2qvca2, d2qvcb2, d2qvcc2, d2qvcd2
   automated match to d2fn8a_
   complexed with bgc

Details for d2qvcb1

PDB Entry: 2qvc, 2.4 Å

PDB Description: crystal structure of a periplasmic sugar abc transporter from thermotoga maritima

PDB Compounds: (B:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d2qvcb1:

Sequence; same for both SEQRES and ATOM records:

>d2qvcb1 c.93.1.0 (B:33-333) automated matches {Thermotoga maritima [TaxId: 243274]}
tigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvngia
iapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkellgg
kgkvvigtgsltamnslqriqgfkdaikdseieivdilndeedgaravslaeaalnahpd
ldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpymmg
ylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelgip
i

Timeline for d2qvcb1:

• d2qvcb1 first appeared in SCOPe 2.04, called d2qvcb_
  
• d2qvcb1 appears in SCOPe 2.07