Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [187722] (4 PDB entries) |
Domain d2qvcb1: 2qvc B:33-333 [243649] Other proteins in same PDB: d2qvca2, d2qvcb2, d2qvcc2, d2qvcd2 automated match to d2fn8a_ complexed with bgc |
PDB Entry: 2qvc (more details), 2.4 Å
SCOPe Domain Sequences for d2qvcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qvcb1 c.93.1.0 (B:33-333) automated matches {Thermotoga maritima [TaxId: 243274]} tigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvngia iapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkellgg kgkvvigtgsltamnslqriqgfkdaikdseieivdilndeedgaravslaeaalnahpd ldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpymmg ylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelgip i
Timeline for d2qvcb1: