Lineage for d2qt6b1 (2qt6 B:1-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772537Species Lentinus tigrinus [TaxId:5365] [255573] (1 PDB entry)
  8. 2772541Domain d2qt6b1: 2qt6 B:1-131 [243641]
    automated match to d1a65a1
    complexed with ca, cl, cu, gol, man, nag, per, tla

Details for d2qt6b1

PDB Entry: 2qt6 (more details), 1.5 Å

PDB Description: crystal structure determination of a blue laccase from lentinus tigrinus
PDB Compounds: (B:) laccase

SCOPe Domain Sequences for d2qt6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qt6b1 b.6.1.0 (B:1-131) automated matches {Lentinus tigrinus [TaxId: 5365]}
avgpvadltvtnanivpdgferaaivvnnvfpaplitgnmgdnfqlnlvnqmtnhtmlkt
tsihwhgffqkgtnwadgpafinqcpiasgnsflydfqvpgqagtfwyhshlstqycdgl
rgpfvvydpnd

SCOPe Domain Coordinates for d2qt6b1:

Click to download the PDB-style file with coordinates for d2qt6b1.
(The format of our PDB-style files is described here.)

Timeline for d2qt6b1: