Lineage for d2qt6a3 (2qt6 A:300-498)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528843Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1528844Protein automated matches [190824] (20 species)
    not a true protein
  7. 1529001Species Lentinus tigrinus [TaxId:5365] [255573] (1 PDB entry)
  8. 1529004Domain d2qt6a3: 2qt6 A:300-498 [243640]
    automated match to d1a65a3
    complexed with ca, cbs, cl, cu, gol, man, nag, per, tla

Details for d2qt6a3

PDB Entry: 2qt6 (more details), 1.5 Å

PDB Description: crystal structure determination of a blue laccase from lentinus tigrinus
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2qt6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qt6a3 b.6.1.0 (A:300-498) automated matches {Lentinus tigrinus [TaxId: 5365]}
letdlhpltsmpvpgnptqggadlnlnmafnfdgtnffingesftpptvpvllqiisgan
taqdllpsgsvyslpsnssieitfpattaapgaphpfhlhghvfavvrsagstsynyddp
vwrdvvstgtpqagdnvtirfqtdnpgpwflhchidfhldagfavvmaedipntvnanpv
pqawsnlcptydalepsne

SCOPe Domain Coordinates for d2qt6a3:

Click to download the PDB-style file with coordinates for d2qt6a3.
(The format of our PDB-style files is described here.)

Timeline for d2qt6a3: