SCOPe 2.06: Domain d2qsua_: 2qsu A:

Lineage for d2qsua_ (2qsu A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196600] (6 PDB entries)

8. Domain d2qsua_: 2qsu A: [243636]
   automated match to d2h8ga_

Details for d2qsua_

PDB Entry: 2qsu, 2 Å

PDB Description: Structure of Arabidopsis thaliana 5'-Methylthioadenosine nucleosidase in apo form

PDB Compounds: (A:) 5'-Methylthioadenosine Nucleosidase

SCOPe Domain Sequences for d2qsua_:

Sequence; same for both SEQRES and ATOM records:

>d2qsua_ c.56.2.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eilrpissvvfviamqaealplvnkfglsettdsplgkglpwvlyhgvhkdlrinvvcpg
rdaalgidsvgtvpaslitfasiqalkpdiiinagtcggfkvkganigdvflvsdvvfhd
rripipmfdlygvglrqafstpnllkelnlkigrlstgdsldmstqdetliiandatlkd
megaavayvadllkipvvflkavtdlvdgdkptaeeflqnltvvtaalegtatkvinfin
grnlsdl

Timeline for d2qsua_:

• d2qsua_ first appeared in SCOPe 2.04
  
• d2qsua_ appears in SCOPe 2.05
  
• d2qsua_ appears in SCOPe 2.07
  
• d2qsua_ appears in the current release, SCOPe 2.08