Class a: All alpha proteins [46456] (290 folds) |
Fold a.189: XPC-binding domain-like [101237] (1 superfamily) 4 helices; array |
Superfamily a.189.1: XPC-binding domain [101238] (2 families) |
Family a.189.1.0: automated matches [254270] (1 protein) not a true family |
Protein automated matches [254625] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255572] (2 PDB entries) |
Domain d2qshx_: 2qsh X: [243635] automated match to d1x3wb1 protein/DNA complex |
PDB Entry: 2qsh (more details), 2.81 Å
SCOPe Domain Sequences for d2qshx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qshx_ a.189.1.0 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav
Timeline for d2qshx_: