SCOPe 2.05: Domain d2qqba3: 2qqb A:149-226

Lineage for d2qqba3 (2qqb A:149-226)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d2qqba3: 2qqb A:149-226 [243629]
   Other proteins in same PDB: d2qqba1, d2qqba2
   automated match to d2dtra3
   protein/DNA complex; complexed with ni, po4

Details for d2qqba3

PDB Entry: 2qqb, 1.92 Å

PDB Description: crystal structure of dtxr(m10a c102d) complexed with nickel(ii)

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2qqba3:

Sequence, based on SEQRES records:

>d2qqba3 b.34.1.2 (A:149-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
gtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshng
kdvellddlahtirieel

Sequence, based on observed residues (ATOM records):

>d2qqba3 b.34.1.2 (A:149-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
gtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrghitlshngk
dvellddlahtirieel

Timeline for d2qqba3:

• d2qqba3 first appeared in SCOPe 2.04
  
• d2qqba3 appears in SCOPe 2.06
  
• d2qqba3 appears in the current release, SCOPe 2.08