Lineage for d2qqaa3 (2qqa A:147-226)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392351Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2392417Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2392418Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 2392419Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
    Uniprot P33120
  8. 2392421Domain d2qqaa3: 2qqa A:147-226 [243626]
    Other proteins in same PDB: d2qqaa1, d2qqaa2
    automated match to d2dtra3
    protein/DNA complex; complexed with ni, po4

Details for d2qqaa3

PDB Entry: 2qqa (more details), 2.1 Å

PDB Description: crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2qqaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqaa3 b.34.1.2 (A:147-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
apgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlsh
ngkdvellddlahtirieel

SCOPe Domain Coordinates for d2qqaa3:

Click to download the PDB-style file with coordinates for d2qqaa3.
(The format of our PDB-style files is described here.)

Timeline for d2qqaa3: