Lineage for d2qqaa2 (2qqa A:65-140)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496027Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1496028Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 1496029Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 1496030Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 1496031Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 1496034Domain d2qqaa2: 2qqa A:65-140 [243625]
    Other proteins in same PDB: d2qqaa1, d2qqaa3
    automated match to d2dtra2
    protein/DNA complex; complexed with ni, po4

Details for d2qqaa2

PDB Entry: 2qqa (more details), 2.1 Å

PDB Description: crystal structure of dtxr(e9a c102d) complexed with nickel(ii)
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2qqaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqaa2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOPe Domain Coordinates for d2qqaa2:

Click to download the PDB-style file with coordinates for d2qqaa2.
(The format of our PDB-style files is described here.)

Timeline for d2qqaa2: