Lineage for d2qq9a3 (2qq9 A:150-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782726Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2782792Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2782793Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 2782794Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
    Uniprot P33120
  8. 2782797Domain d2qq9a3: 2qq9 A:150-226 [243623]
    Other proteins in same PDB: d2qq9a1, d2qq9a2
    automated match to d2dtra3
    protein/DNA complex; complexed with ni, po4

Details for d2qq9a3

PDB Entry: 2qq9 (more details), 1.71 Å

PDB Description: crystal structure of dtxr(d6a c102d) complexed with nickel(ii)
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2qq9a3:

Sequence, based on SEQRES records: (download)

>d2qq9a3 b.34.1.2 (A:150-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
trvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshngk
dvellddlahtirieel

Sequence, based on observed residues (ATOM records): (download)

>d2qq9a3 b.34.1.2 (A:150-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
trvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngkdv
ellddlahtirieel

SCOPe Domain Coordinates for d2qq9a3:

Click to download the PDB-style file with coordinates for d2qq9a3.
(The format of our PDB-style files is described here.)

Timeline for d2qq9a3: