SCOPe 2.08: Domain d2qq9a3: 2qq9 A:150-226

Lineage for d2qq9a3 (2qq9 A:150-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d2qq9a3: 2qq9 A:150-226 [243623]
   Other proteins in same PDB: d2qq9a1, d2qq9a2
   automated match to d2dtra3
   protein/DNA complex; complexed with ni, po4

Details for d2qq9a3

PDB Entry: 2qq9, 1.71 Å

PDB Description: crystal structure of dtxr(d6a c102d) complexed with nickel(ii)

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2qq9a3:

Sequence, based on SEQRES records:

>d2qq9a3 b.34.1.2 (A:150-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
trvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshngk
dvellddlahtirieel

Sequence, based on observed residues (ATOM records):

>d2qq9a3 b.34.1.2 (A:150-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
trvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngkdv
ellddlahtirieel

Timeline for d2qq9a3:

• d2qq9a3 first appeared in SCOPe 2.04
  
• d2qq9a3 appears in SCOPe 2.07