Lineage for d1bgle4 (1bgl E:731-1023)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12903Fold b.30: Supersandwich [49993] (3 superfamilies)
  4. 12904Superfamily b.30.1: beta-Galactosidase, domain 5 [49994] (1 family) (S)
  5. 12905Family b.30.1.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 12906Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 12907Species Escherichia coli [TaxId:562] [49997] (7 PDB entries)
  8. 12916Domain d1bgle4: 1bgl E:731-1023 [24362]
    Other proteins in same PDB: d1bgla1, d1bgla2, d1bgla3, d1bgla5, d1bglb1, d1bglb2, d1bglb3, d1bglb5, d1bglc1, d1bglc2, d1bglc3, d1bglc5, d1bgld1, d1bgld2, d1bgld3, d1bgld5, d1bgle1, d1bgle2, d1bgle3, d1bgle5, d1bglf1, d1bglf2, d1bglf3, d1bglf5, d1bglg1, d1bglg2, d1bglg3, d1bglg5, d1bglh1, d1bglh2, d1bglh3, d1bglh5

Details for d1bgle4

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)

SCOP Domain Sequences for d1bgle4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgle4 b.30.1.1 (E:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1bgle4:

Click to download the PDB-style file with coordinates for d1bgle4.
(The format of our PDB-style files is described here.)

Timeline for d1bgle4: