Lineage for d2qq2i_ (2qq2 I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944410Species Human (Homo sapiens) [TaxId:9606] [255571] (3 PDB entries)
  8. 2944419Domain d2qq2i_: 2qq2 I: [243617]
    automated match to d1vpmb_

Details for d2qq2i_

PDB Entry: 2qq2 (more details), 2.8 Å

PDB Description: Crystal structure of C-terminal domain of Human acyl-CoA thioesterase 7
PDB Compounds: (I:) cytosolic acyl coenzyme a thioester hydrolase

SCOPe Domain Sequences for d2qq2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qq2i_ d.38.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pepntvsysqsslihlvgpsdctlhgfvhggvtmklmdevagivaarhcktnivtasvda
infhdkirkgcvitisgrmtftsnksmeievlvdadpvvdssqkryraasafftyvslsq
egrslpvpqlvpetedekkrfeegkgrylqmkak

SCOPe Domain Coordinates for d2qq2i_:

Click to download the PDB-style file with coordinates for d2qq2i_.
(The format of our PDB-style files is described here.)

Timeline for d2qq2i_: