Lineage for d2qoka_ (2qok A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1053 PDB entries)
  8. 2546372Domain d2qoka_: 2qok A: [243603]
    automated match to d3pp0b_
    complexed with bme; mutant

Details for d2qoka_

PDB Entry: 2qok (more details), 1.2 Å

PDB Description: human epha3 kinase and juxtamembrane region, y596f:y602f:s768a triple mutant
PDB Compounds: (A:) Ephrin receptor

SCOPe Domain Sequences for d2qoka_:

Sequence, based on SEQRES records: (download)

>d2qoka_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfvdphtfedptqtvhefakeldatnisidkvvgagefgevcsgrlklpskkeisvaikt
lkvgytekqrrdflgeasimgqfdhpniirlegvvtkskpvmivteymengsldsflrkh
daqftviqlvgmlrgiasgmkylsdmgyvhrdlaarnilinsnlvckvsdfglarvledd
peaayttrggkipirwtspeaiayrkftsasdvwsygivlwevmsygerpywemsnqdvi
kavdegyrlpppmdcpaalyqlmldcwqkdrnnrpkfeqivsildklirnpgslkiitsa
aarpsnllld

Sequence, based on observed residues (ATOM records): (download)

>d2qoka_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfvdpvhefakeldatnisidkvvgagefgevcsgrlklpskkeisvaiktlkvgytekq
rrdflgeasimgqfdhpniirlegvvtkskpvmivteymengsldsflrkhdaqftviql
vgmlrgiasgmkylsdmgyvhrdlaarnilinsnlvckvsdfglarvipirwtspeaiay
rkftsasdvwsygivlwevmsygerpywemsnqdvikavdegyrlpppmdcpaalyqlml
dcwqkdrnnrpkfeqivsildklirnpgslkiitpsnllld

SCOPe Domain Coordinates for d2qoka_:

Click to download the PDB-style file with coordinates for d2qoka_.
(The format of our PDB-style files is described here.)

Timeline for d2qoka_: