SCOPe 2.08: Domain d2qlwa1: 2qlw A:2-106

Lineage for d2qlwa1 (2qlw A:2-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Rhizobium leguminosarum [TaxId:386] [188716] (2 PDB entries)

8. Domain d2qlwa1: 2qlw A:2-106 [243589]
   Other proteins in same PDB: d2qlwa2, d2qlwb2
   automated match to d2qlxa_
   complexed with fmt, mg

Details for d2qlwa1

PDB Entry: 2qlw, 1.6 Å

PDB Description: crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum

PDB Compounds: (A:) RhaU

SCOPe Domain Sequences for d2qlwa1:

Sequence; same for both SEQRES and ATOM records:

>d2qlwa1 d.58.4.0 (A:2-106) automated matches {Rhizobium leguminosarum [TaxId: 386]}
tlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvltrp
kdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp

Timeline for d2qlwa1:

• d2qlwa1 first appeared in SCOPe 2.04, called d2qlwa_
  
• d2qlwa1 appears in SCOPe 2.07