SCOPe 2.05: Domain d2qk4b3: 2qk4 B:330-430

Lineage for d2qk4b3 (2qk4 B:330-430)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255567] (1 PDB entry)

8. Domain d2qk4b3: 2qk4 B:330-430 [243588]
   Other proteins in same PDB: d2qk4a1, d2qk4a2, d2qk4b1, d2qk4b2
   automated match to d1gsoa1
   complexed with atp, cl, gol, so4

Details for d2qk4b3

PDB Entry: 2qk4, 2.45 Å

PDB Description: Human glycinamide ribonucleotide synthetase

PDB Compounds: (B:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d2qk4b3:

Sequence; same for both SEQRES and ATOM records:

>d2qk4b3 b.84.2.0 (B:330-430) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enhtaltvvmaskgypgdytkgveitgfpeaqalglevfhagtalkngkvvthggrvlav
tairenlisaleeakkglaaikfegaiyrkdigfraiaflq

Timeline for d2qk4b3:

• d2qk4b3 first appeared in SCOPe 2.04
  
• d2qk4b3 appears in SCOPe 2.06
  
• d2qk4b3 appears in the current release, SCOPe 2.08