SCOPe 2.08: Domain d2qk4b1: 2qk4 B:1-105

Lineage for d2qk4b1 (2qk4 B:1-105)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225246] (2 PDB entries)

8. Domain d2qk4b1: 2qk4 B:1-105 [243586]
   Other proteins in same PDB: d2qk4a2, d2qk4a3, d2qk4a4, d2qk4b2, d2qk4b3, d2qk4b4
   automated match to d1gsoa2
   complexed with atp, cl, gol, so4

Details for d2qk4b1

PDB Entry: 2qk4, 2.45 Å

PDB Description: Human glycinamide ribonucleotide synthetase

PDB Compounds: (B:) Trifunctional purine biosynthetic protein adenosine-3

SCOPe Domain Sequences for d2qk4b1:

Sequence; same for both SEQRES and ATOM records:

>d2qk4b1 c.30.1.0 (B:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maarvliigsggrehtlawklaqshhvkqvlvapgnagtacsekisntaisisdhtalaq
fckekkiefvvvgpeaplaagivgnlrsagvqcfgptaeaaqles

Timeline for d2qk4b1:

• d2qk4b1 first appeared in SCOPe 2.04
  
• d2qk4b1 appears in SCOPe 2.07