Lineage for d1bgla4 (1bgl A:731-1023)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2044683Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2044684Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2044692Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2044825Domain d1bgla4: 1bgl A:731-1023 [24358]
    Other proteins in same PDB: d1bgla1, d1bgla2, d1bgla3, d1bgla5, d1bglb1, d1bglb2, d1bglb3, d1bglb5, d1bglc1, d1bglc2, d1bglc3, d1bglc5, d1bgld1, d1bgld2, d1bgld3, d1bgld5, d1bgle1, d1bgle2, d1bgle3, d1bgle5, d1bglf1, d1bglf2, d1bglf3, d1bglf5, d1bglg1, d1bglg2, d1bglg3, d1bglg5, d1bglh1, d1bglh2, d1bglh3, d1bglh5
    complexed with mg
    complexed with mg

Details for d1bgla4

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1bgla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgla4 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1bgla4:

Click to download the PDB-style file with coordinates for d1bgla4.
(The format of our PDB-style files is described here.)

Timeline for d1bgla4: