Lineage for d2qfdh_ (2qfd H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407553Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2407630Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2407631Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 protein domains)
  6. 2407638Protein RIG-I C-terminal domain [254412] (1 species)
  7. 2407639Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)
  8. 2407651Domain d2qfdh_: 2qfd H: [243576]
    automated match to d2qfba_
    complexed with hg

Details for d2qfdh_

PDB Entry: 2qfd (more details), 2.7 Å

PDB Description: Crystal structure of the regulatory domain of human RIG-I with bound Hg
PDB Compounds: (H:) Probable ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d2qfdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfdh_ b.88.2.1 (H:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
m

SCOPe Domain Coordinates for d2qfdh_:

Click to download the PDB-style file with coordinates for d2qfdh_.
(The format of our PDB-style files is described here.)

Timeline for d2qfdh_: