Lineage for d2qfdg_ (2qfd G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810140Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 1810210Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 1810211Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)
  6. 1810218Protein RIG-I C-terminal domain [254412] (1 species)
  7. 1810219Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)
  8. 1810230Domain d2qfdg_: 2qfd G: [243575]
    automated match to d2qfba_
    complexed with hg

Details for d2qfdg_

PDB Entry: 2qfd (more details), 2.7 Å

PDB Description: Crystal structure of the regulatory domain of human RIG-I with bound Hg
PDB Compounds: (G:) Probable ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d2qfdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfdg_ b.88.2.1 (G:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
m

SCOPe Domain Coordinates for d2qfdg_:

Click to download the PDB-style file with coordinates for d2qfdg_.
(The format of our PDB-style files is described here.)

Timeline for d2qfdg_: