SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qfdg_ (2qfd G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073241Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2073314Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2073315Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 protein domains)
  6. 2073322Protein RIG-I C-terminal domain [254412] (1 species)
  7. 2073323Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)
  8. 2073334Domain d2qfdg_: 2qfd G: [243575]
    automated match to d2qfba_
    complexed with hg

Details for d2qfdg_

PDB Entry: 2qfd (more details), 2.7 Å

PDB Description: Crystal structure of the regulatory domain of human RIG-I with bound Hg
PDB Compounds: (G:) Probable ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d2qfdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfdg_ b.88.2.1 (G:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
m

SCOPe Domain Coordinates for d2qfdg_:

Click to download the PDB-style file with coordinates for d2qfdg_.
(The format of our PDB-style files is described here.)

Timeline for d2qfdg_: