Lineage for d2qfbj_ (2qfb J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818899Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2818988Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2818989Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)
  6. 2818996Protein RIG-I C-terminal domain [254412] (1 species)
  7. 2818997Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)
  8. 2819021Domain d2qfbj_: 2qfb J: [243568]
    complexed with zn

Details for d2qfbj_

PDB Entry: 2qfb (more details), 3 Å

PDB Description: Crystal structure of the regulatory domain of human RIG-I with bound Zn
PDB Compounds: (J:) Probable ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d2qfbj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfbj_ b.88.2.1 (J:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
m

SCOPe Domain Coordinates for d2qfbj_:

Click to download the PDB-style file with coordinates for d2qfbj_.
(The format of our PDB-style files is described here.)

Timeline for d2qfbj_: