Lineage for d2qfbi_ (2qfb I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428233Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2428320Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2428321Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)
  6. 2428328Protein RIG-I C-terminal domain [254412] (1 species)
  7. 2428329Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)
  8. 2428352Domain d2qfbi_: 2qfb I: [243567]
    complexed with zn

Details for d2qfbi_

PDB Entry: 2qfb (more details), 3 Å

PDB Description: Crystal structure of the regulatory domain of human RIG-I with bound Zn
PDB Compounds: (I:) Probable ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d2qfbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfbi_ b.88.2.1 (I:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki
fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
m

SCOPe Domain Coordinates for d2qfbi_:

Click to download the PDB-style file with coordinates for d2qfbi_.
(The format of our PDB-style files is described here.)

Timeline for d2qfbi_: