Class b: All beta proteins [48724] (178 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) Pfam PF11648 |
Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins) |
Protein RIG-I C-terminal domain [254412] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries) |
Domain d2qfbd_: 2qfb D: [243562] complexed with zn |
PDB Entry: 2qfb (more details), 3 Å
SCOPe Domain Sequences for d2qfbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfbd_ b.88.2.1 (D:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} kenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekraki fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae m
Timeline for d2qfbd_: