Lineage for d2qeqa1 (2qeq A:187-483)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113070Family c.37.1.14: RNA helicase [52724] (4 protein domains)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2113149Protein automated matches [226986] (8 species)
    not a true protein
  7. 2113172Species West nile virus [TaxId:11078] [255564] (1 PDB entry)
  8. 2113173Domain d2qeqa1: 2qeq A:187-483 [243555]
    Other proteins in same PDB: d2qeqa2, d2qeqb2
    automated match to d2bhra2

Details for d2qeqa1

PDB Entry: 2qeq (more details), 3.1 Å

PDB Description: Crystal structure of kunjin virus ns3 helicase
PDB Compounds: (A:) Flavivirin protease NS3 catalytic subunit

SCOPe Domain Sequences for d2qeqa1:

Sequence, based on SEQRES records: (download)

>d2qeqa1 c.37.1.14 (A:187-483) automated matches {West nile virus [TaxId: 11078]}
kqitvldlhpgagktrrilpqiikeainrrlrtavlaptrvvaaemaealrglpiryqts
avarehngneivdvmchatlthrlmsphrvpnynlfvmdeahftdpasiaargyistrve
lgeaaaifmtatppgtsdpfpesnapisdlqteipdrawnsgyewiteyigktvwfvpsv
kmgneialclqragkkviqlnrksyeteypkcknddwdfvvttdisemganfkasrvids
rksvkptiitegegrvilgepsavtaasaaqrrgrtgrnpsqagdeycygghtnedd

Sequence, based on observed residues (ATOM records): (download)

>d2qeqa1 c.37.1.14 (A:187-483) automated matches {West nile virus [TaxId: 11078]}
kqitvldlhpgagktrrilpqiikeainrrlrtavlaptrvvaaemaealrglpiryqts
angneivdvmchatlthrlmsphrvpnynlfvmdeahftdpasiaargyistrvelgeaa
aifmtatppgtsdpfpesnapisdlqteipdrawnsgyewiteyigktvwfvpsvkmgne
ialclqragkkviqlnrnddwdfvvttdisemganfkasrvidsrksvkptiitegegrv
ilgepsavtaasaaqrrgrtgrnpsqagdeycygghtnedd

SCOPe Domain Coordinates for d2qeqa1:

Click to download the PDB-style file with coordinates for d2qeqa1.
(The format of our PDB-style files is described here.)

Timeline for d2qeqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qeqa2